PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10016434m
Common NameCARUB_v10016434mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 327aa    MW: 36973.2 Da    PI: 6.9548
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10016434mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.27.8e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+  ++++G g+W++ ++  g++R++k+c++rw +yl
  Carubv10016434m 14 KGPWTPEEDQKLIYHIRKHGHGSWRALPKQAGLNRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding57.33.6e-1867111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++T+eE++ +++++ +lG++ W++Ia +++ gRt++++k++w+++
  Carubv10016434m  67 RGNFTAEEEQTIINLHSLLGNK-WSSIAGHLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-26564IPR009057Homeodomain-like
PROSITE profilePS5129417.821961IPR017930Myb domain
SuperFamilySSF466891.94E-3211108IPR009057Homeodomain-like
SMARTSM007172.1E-151363IPR001005SANT/Myb domain
PfamPF002492.0E-161461IPR001005SANT/Myb domain
CDDcd001675.24E-121661No hitNo description
PROSITE profilePS5129427.39462116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.0E-2765117IPR009057Homeodomain-like
SMARTSM007172.2E-1666114IPR001005SANT/Myb domain
PfamPF002492.1E-1667111IPR001005SANT/Myb domain
CDDcd001679.19E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MGRSPCCDES GLKKGPWTPE EDQKLIYHIR KHGHGSWRAL PKQAGLNRCG KSCRLRWTNY  60
LRPDIKRGNF TAEEEQTIIN LHSLLGNKWS SIAGHLPGRT DNEIKNYWNT HIRKKLMQMG  120
IDPVTHRPRT DHLNVLAALP QLLAAANFNN LLNLNQNIQL DATSVAKAQL LHSMIQVLSN  180
NNNASSSLET HHTNNNNLFG QSSFLENLPS IGENLYDQTQ SLSHIVNQPP LDSFTSPIRV  240
VAHQDYQNSI PPLISASPDD ESKQTQMMAK NKEVLRHTDH TSNPSSTSTF TQDHQPWCDV  300
IDDEASDSYW KDIIEQTCSE TWPFRE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-30121165108B-MYB
1h8a_C1e-291211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00327DAPTransfer from AT3G02940Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF2493100.0AF249310.2 Arabidopsis thaliana putative transcription factor (MYB107) mRNA, complete cds.
GenBankAY5195830.0AY519583.1 Arabidopsis thaliana MYB transcription factor (At3g02940) mRNA, complete cds.
GenBankBT0256600.0BT025660.1 Arabidopsis thaliana At3g02940 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006300198.10.0hypothetical protein CARUB_v10016434mg
TrEMBLR0GBX10.0R0GBX1_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.3__241__AT3G02940.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02940.10.0myb domain protein 107